You can find more information about
using the following links:
PlasmoDB - the Plasmodium genome resource
The TDR Targets Database
Subcellular Localization
Picture 1
Picture 2
Picture 3
Picture 4
Picture 5
Affecting Drugs
Drug Name
PubMed Articles (year of publication)
Bipartite peptides containing dpt-sh1 and pp1- or pp2a-interacting sequences.
Use of penetrating peptides interacting with PP1/PP2A proteins as a general approach for a drug phosphatase technology(2006)
Leucine-rich repeat protein
Regulation of protein phosphatase type 1 and cell cycle progression by PfLRR1, a novel leucine-rich repeat protein of the human malaria parasite Plasmodium falciparum(2006)
Sirna, suggested target
Characterisation and expression of a PP1 serine/threonine protein phosphatase (PfPP1) from the malaria parasite, Plasmodium falciparum: demonstration of its essential role using RNA interference(2002)
VKKKKIKAEIKIENYRKTIIHLPQLKQLDAL
Peptides derived from Plasmodium falciparum leucine-rich repeat 1 bind to serine/threonine phosphatase type 1 and inhibit parasite growth in vitro(2018)