You can find more information about serine/threonine protein phosphatase PP1 using the following links:

PFID

PFID Old

Formal Annotation

PlasmoDB

TDR Targets

Subcellular Localization

Affecting Drugs

Drug Name

PubMed Articles (year of publication)

PF3D7_1414400

PF14_0142

serine/threonine protein phosphatase PP1

Bipartite peptides containing dpt-sh1 and pp1- or pp2a-interacting sequences.	Use of penetrating peptides interacting with PP1/PP2A proteins as a general approach for a drug phosphatase technology
Leucine-rich repeat protein	Regulation of protein phosphatase type 1 and cell cycle progression by PfLRR1, a novel leucine-rich repeat protein of the human malaria parasite Plasmodium falciparum
Sirna, suggested target	Characterisation and expression of a PP1 serine/threonine protein phosphatase (PfPP1) from the malaria parasite, Plasmodium falciparum: demonstration of its essential role using RNA interference
VKKKKIKAEIKIENYRKTIIHLPQLKQLDAL	Peptides derived from Plasmodium falciparum leucine-rich repeat 1 bind to serine/threonine phosphatase type 1 and inhibit parasite growth in vitro

Expasy - NiceZime View
Brenda - The Comprehensive Enzyme Information System